PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK11632.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NF-YC
Protein Properties Length: 146aa    MW: 16684.2 Da    PI: 10.1434
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK11632.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC475.7e-1537128899
      NF-YC   8 kqiekatdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprd 99 
                ++ e+++d k +++P+ ri++i+++d+   +is ea  l+ ka e fi ++   +   a + ++++l    ++++v++ + +dfl d vp++
  PK11632.1  37 EEPEESEDAKMNKFPMERIRRIVRSDDPDMRISNEAVFLVNKATEKFIEKFCGDAHACAIKDRKKALAYKHLSSVVSKRKRYDFLSDFVPEK 128
                4578999******************999999**********************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471131.33E-1843127IPR009072Histone-fold
PfamPF008082.0E-1649112IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.102.3E-2350127IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
PEVENGSVLI TKNLTTSTPT KSSNGKQKKQ KKRERKEEPE ESEDAKMNKF PMERIRRIVR  60
SDDPDMRISN EAVFLVNKAT EKFIEKFCGD AHACAIKDRK KALAYKHLSS VVSKRKRYDF  120
LSDFVPEKVK AVDALAERKL LEAEAA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2byk_A4e-14351315102CHRAC-16
2byk_C4e-14351315102CHRAC-16
2bym_A4e-14351315102CHRAC-16
2bym_C4e-14351315102CHRAC-16
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12735KKQKKRERK
298116RKKALAYKHLSSVVSKRKR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008358413.14e-54PREDICTED: DNA polymerase epsilon subunit C
TrEMBLM5W7G17e-52M5W7G1_PRUPE; Uncharacterized protein
STRINGPOPTR_0009s01750.12e-38(Populus trichocarpa)
STRINGGLYMA11G20740.15e-38(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120163031
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07980.18e-32nuclear factor Y, subunit C10